PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011085628.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family M-type_MADS
Protein Properties Length: 192aa    MW: 22176.8 Da    PI: 9.9674
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011085628.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF34.82.1e-111252242
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-T CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifss 42
                    +i+ +++r+v   kR + + KKA+ELS+LC++++ ++i  +
  XP_011085628.1 12 QISTERKRKVLCMKRVESLTKKANELSILCGINIGIVIHKP 52
                    79999*******************************99765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006613.54349IPR002100Transcription factor, MADS-box
SMARTSM004329.4E-9362IPR002100Transcription factor, MADS-box
SuperFamilySSF554554.32E-17496IPR002100Transcription factor, MADS-box
CDDcd002661.06E-15486No hitNo description
PfamPF003192.4E-121354IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MHMTRKRVKH EQISTERKRK VLCMKRVESL TKKANELSIL CGINIGIVIH KPTENNAILW  60
PSLEVFGDRL QKFLDFSGSE RAKKMVTHEK FLHQRVNDGI EEISKSQYKK ELKESQLVMT  120
QLLIQGKDFG AIDLVQLNCL QSFAAQMLKK LQFKDDELNE QERQMLTPPP SPPSFPPFHM  180
MVSNKDQPTS SV
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1419RKRVKHEQISTERKRK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011085628.11e-141PREDICTED: agamous-like MADS-box protein AGL80
TrEMBLA0A022Q2117e-35A0A022Q211_ERYGU; Uncharacterized protein (Fragment)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37820129
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G05860.22e-17M-type_MADS family protein